Antibodies

Jump to Filters
View as table Download
GMP Synthase (GMPS) Rabbit Polyclonal Antibody
TA346719

USD 475.00

5 Days

Rabbit Polyclonal Anti-GMPS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GMPS antibody: synthetic peptide directed towards the middle region of human GMPS. Synthetic peptide located within the following region: VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA
GMP Synthase (GMPS) Rabbit Polyclonal Antibody
TA376627

USD 220.00

3 Weeks

GMPS Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 394-693 of human GMPS (NP_003866.1).
Modifications Unmodified