Antibodies

Jump to Filters
View as table Download
LYPD3 Rabbit Polyclonal Antibody
TA590533

USD 409.00

In Stock

Rabbit Polyclonal LYPD3 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
LYPD3 Rabbit Polyclonal Antibody
TA316986

USD 425.00

5 Days

C4.4A / LYPD3 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Gorilla, Gibbon
Conjugation Unconjugated
Immunogen C4.4A / LYPD3 antibody was raised against synthetic 16 amino acid peptide from C-Terminus of human LYPD3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%).
LYPD3 Rabbit Polyclonal Antibody
TA338089

USD 375.00

5 Days

Rabbit Polyclonal Anti-LYPD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYPD3 antibody is: synthetic peptide directed towards the C-terminal region of Human LYPD3. Synthetic peptide located within the following region: SRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGCVAPTAGLAALLL
LYPD3 Rabbit Polyclonal Antibody
TA338090

USD 375.00

5 Days

Rabbit Polyclonal Anti-LYPD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYPD3 antibody is: synthetic peptide directed towards the C-terminal region of Human LYPD3. Synthetic peptide located within the following region: PVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQ
LYPD3 Rabbit Polyclonal Antibody
TA378177

USD 220.00

3 Weeks

LYPD3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 31-326 of human LYPD3 (NP_055215.2).
Modifications Unmodified