Antibodies

View as table Download

ME2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ME2

Rabbit Polyclonal Anti-ME2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ME2 antibody: synthetic peptide directed towards the N terminal of human ME2. Synthetic peptide located within the following region: MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG

ME2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ME2

ME2 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-479 of human ME2 (NP_001161807.1).
Modifications Unmodified