Antibodies

View as table Download

Rabbit Polyclonal Anti-MYH1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MYH1

Rabbit Polyclonal Anti-MYH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYH1 antibody: synthetic peptide directed towards the N terminal of human MYH1. Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK

MYH1 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MYH1

MYH1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MYH1 (NP_005954.3).
Modifications Unmodified

MYH polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MYH-pan around the non-acetylation site of Lys1394. AA range:1351-1400