Antibodies

Jump to Filters
View as table Download
PLD6 Rabbit Polyclonal Antibody
TA334803

USD 375.00

5 Days

Rabbit Polyclonal Anti-PLD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLD6 antibody is: synthetic peptide directed towards the C-terminal region of Human PLD6. Synthetic peptide located within the following region: ITEDDEYVRLFLEEFERIWEQFNPTKYTFFPPKKSHGSCAPPVSRAGGRL