Antibodies

View as table Download

Rabbit Polyclonal Anti-SELPLG Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SELPLG

SELPLG Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human SELPLG

Rabbit Polyclonal Anti-SELPLG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SELPLG antibody is: synthetic peptide directed towards the C-terminal region of Human SELPLG. Synthetic peptide located within the following region: EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSF

Rabbit Polyclonal Anti-SELPLG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SELPLG antibody is: synthetic peptide directed towards the N-terminal region of Human SELPLG. Synthetic peptide located within the following region: GNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLR

SELPLG rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SELPLG