Antibodies

Jump to Filters
View as table Download
TGIF (TGIF1) Rabbit Polyclonal Antibody
TA590367

USD 409.00

In Stock

Rabbit Polyclonal TGIF Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
TGIF (TGIF1) Rabbit Polyclonal Antibody
TA339200

USD 375.00

5 Days

Rabbit Polyclonal Anti-TGIF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TGIF1 antibody: synthetic peptide directed towards the C terminal of human TGIF1. Synthetic peptide located within the following region: GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN
TGIF (TGIF1) Rabbit Polyclonal Antibody
TA382480

USD 220.00

3 Weeks

TGIF1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 123-272 of human TGIF1 (NP_003235.1).