Antibodies

View as table Download

Rabbit Polyclonal Anti-ACBD3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACBD3 antibody: synthetic peptide directed towards the N terminal of human ACBD3. Synthetic peptide located within the following region: EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL

Rabbit Polyclonal GOLPH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen GOLPH1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human GOLPH1.