Rabbit Polyclonal Anti-BTNL8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BTNL8 antibody: synthetic peptide directed towards the N terminal of human BTNL8. Synthetic peptide located within the following region: MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA |
Rabbit Polyclonal Anti-BTNL8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BTNL8 antibody: synthetic peptide directed towards the middle region of human BTNL8. Synthetic peptide located within the following region: PRPTAKWKGPQGQDLSTDSRTNRDMHGLFDVEISLTVQENAGSISCSMRH |
Germany
Japan
United Kingdom
China