Antibodies

View as table Download

Rabbit polyclonal anti-DECR2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DECR2.

Rabbit Polyclonal Anti-Decr2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Decr2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTFPNGIKQLLE

Rabbit Polyclonal Anti-DECR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DECR2 Antibody: synthetic peptide directed towards the N terminal of human DECR2. Synthetic peptide located within the following region: MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMR