Antibodies

Jump to Filters
View as table Download
E2F8 Rabbit Polyclonal Antibody
TA326941

USD 275.00

3 Weeks

E2F8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human E2F8
E2F8 Rabbit Polyclonal Antibody
TA342480

USD 375.00

5 Days

Rabbit Polyclonal Anti-E2F8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F8 antibody: synthetic peptide directed towards the middle region of human E2F8. Synthetic peptide located within the following region: QLVAESFFRTPGGPTKPTSSSCMDFEGANKTSLGTLFVPQRKLEVSTEDV