Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-EGR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGR2 Antibody: A synthesized peptide derived from human EGR2 |
Antibodies
View as table Download
Rabbit polyclonal EGR2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human EGR2. |
Rabbit Polyclonal Anti-EGR2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGR2 antibody: synthetic peptide directed towards the C terminal of human EGR2. Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG |
Goat Polyclonal Antibody against EGR2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence HGTAGPDRKPFPC, from the internal region of the protein sequence according to NP_000390.2. |
Active filters
Target Symbol
- EGR2
Clonalities
- Polyclonal
Families
- Druggable Genome