Antibodies

View as table Download

Rabbit polyclonal EN1 (Engrailed 1) Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EN1 (Engrailed 1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human EN1 (Engrailed 1).

Rabbit Polyclonal Anti-EN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EN1 antibody: synthetic peptide directed towards the C terminal of human EN1. Synthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK

Rabbit Polyclonal Anti-EN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EN1 antibody: synthetic peptide directed towards the middle region of human EN1. Synthetic peptide located within the following region: LNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDES