Antibodies

View as table Download

Rabbit polyclonal anti-GPR25 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR25.

Rabbit Polyclonal Anti-GPR25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR25 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR25. Synthetic peptide located within the following region: LIYLLLDRSFRARALDGACGRTGRLARRISSASSLSRDDSSVFRCRAQAA

Rabbit Polyclonal Anti-GPR25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR25 Antibody is: synthetic peptide directed towards the middle region of Human GPR25. Synthetic peptide located within the following region: VALLAGLPSLVYRGLQPLPGGQDSQCGEEPSHAFQGLSLLLLLLTFVLPL