Antibodies

View as table Download

Rabbit anti-GRN Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRN

Goat Anti-Granulin / GRN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QSKCLSKENATTD, from the internal region of the protein sequence according to NP_002078.1.

Rabbit polyclonal GRN Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GRN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 563-591 amino acids from the C-terminal region of human GRN.

Rabbit Polyclonal Anti-GRN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRN antibody is: synthetic peptide directed towards the middle region of Human GRN. Synthetic peptide located within the following region: CPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD