Rabbit Polyclonal Anti-K2P5.1 (TASK-2)
Applications | IHC, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)YEQLMNEYNKANSPKGT, amino acid residues 483-499 of human K2P5.1 . Intracellular, C-terminus. |
Rabbit Polyclonal Anti-K2P5.1 (TASK-2)
Applications | IHC, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)YEQLMNEYNKANSPKGT, amino acid residues 483-499 of human K2P5.1 . Intracellular, C-terminus. |
Rabbit polyclonal Anti-KCNK5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNK5 antibody: synthetic peptide directed towards the C terminal of human KCNK5. Synthetic peptide located within the following region: TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES |
Rabbit Polyclonal Anti-Kcnk5 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Kcnk5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AWLSLFVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQMAGSTAS |