Antibodies

View as table Download

Rabbit Polyclonal Anti-LGALS3BP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LGALS3BP antibody: synthetic peptide directed towards the middle region of human LGALS3BP. Synthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS

Rabbit Polyclonal Anti-LGALS3BP Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human LGALS3BP