Rabbit Polyclonal IKB zeta Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to an amino acid range between 270-320 and 670-720 of mouse IkB zeta protein were used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-Nfkbiz Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nfkbiz antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY |
Germany
Japan
United Kingdom
China