Antibodies

View as table Download

Rabbit Polyclonal Anti-NODAL Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NODAL antibody: synthetic peptide directed towards the middle region of human NODAL. Synthetic peptide located within the following region: EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHH

Rabbit Polyclonal Anti-NODAL Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NODAL antibody: synthetic peptide directed towards the N terminal of human NODAL. Synthetic peptide located within the following region: PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ

Anti-NODAL Goat Polyclonal Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Monkey, Pig
Immunogen NODAL antibody was raised against synthetic peptide (DRSQLCRKVKFQ) from internal region of human NODAL. Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Panda, Bovine, Dog, Bat, Horse, Pig (100%); Mouse, Rat, Hamster (92%); Elephant (83%).

Goat Anti-NODAL Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence ECPNPVGEEFH, from the internal region of the protein sequence according to NP_060525.2.