Antibodies

Jump to Filters
View as table Download
AMPK beta 2 (PRKAB2) Goat Polyclonal Antibody
AP22970PU-N

USD 440.00

2 Weeks

AMPK beta 2 (PRKAB2) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human
Immunogen Synthetic peptide from human PRKAB2 / AMPK Beta 2
AMPK beta 2 (PRKAB2) Rabbit Polyclonal Antibody
TA342245

USD 375.00

5 Days

Rabbit polyclonal Anti-PRKAB2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKAB2 antibody: synthetic peptide directed towards the middle region of human PRKAB2. Synthetic peptide located within the following region: RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPA