Rad9 (RAD9A) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Human RAD9A. |
Rad9 (RAD9A) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Human RAD9A. |
Rabbit polyclonal antibody to Rad9 (RAD9 homolog A (S. pombe))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 197 and 391 of Rad9 |
Rabbit Polyclonal Antibody against RAD9A
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This RAD9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human RAD9. |
Rabbit Polyclonal Antibody against RAD9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of full length human Rad9 protein |
Goat Polyclonal Antibody against RAD9A
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QGPSPVLAEDSEGE, from the C Terminus of the protein sequence according to NP_004575.1. |
Anti-RAD9A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 230 amino acids of human RAD9 homolog A (S. pombe) |
Rabbit Polyclonal Anti-RAD9A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAD9A antibody: synthetic peptide directed towards the C terminal of human RAD9A. Synthetic peptide located within the following region: SLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKKFRSLFFGSILAPVRS |