Antibodies

View as table Download

Rabbit polyclonal anti-SC6A6 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SC6A6.

SLC6A6 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated

Rabbit Polyclonal Anti-SLC6A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC6A6 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC6A6. Synthetic peptide located within the following region: EFWERNVLSLSPGIDHPGSLKWDLALCLLLVWLVCFFCIWKGVRSTGKVV