Rabbit polyclonal anti-SC6A6 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SC6A6. |
Rabbit polyclonal anti-SC6A6 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SC6A6. |
SLC6A6 (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit Polyclonal Anti-SLC6A6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC6A6 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC6A6. Synthetic peptide located within the following region: EFWERNVLSLSPGIDHPGSLKWDLALCLLLVWLVCFFCIWKGVRSTGKVV |