Antibodies

View as table Download

Goat Polyclonal Antibody against P2RX4

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-YREKKYKYVEDYEQ, from the C Terminus of the protein sequence according to NP_002551.2.

Rabbit Polyclonal Anti-P2RX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX4 antibody: synthetic peptide directed towards the N terminal of human P2RX4. Synthetic peptide located within the following region: VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW