Rabbit polyclonal anti-NR1I2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NR1I2. |
Rabbit polyclonal anti-NR1I2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NR1I2. |
PXR (NR1I2) (Center) rabbit polyclonal antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 100-127 aa selected from the Center region of human NR1I2 |
Anti-NR1I2 Goat Polyclonal Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | NR1I2 / PXR / PAR antibody was raised against synthetic peptide EQFAITLKSYIECNR from an internal region of human NR1I2 / PXR (NP_003880.3; NP_071285.1; NP_148934.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset (93%); Horse, Pig (87%); Panda, Dog, Rabbit (80%). |
Rabbit Polyclonal Anti-NR1I2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the C terminal of human NR1I2. Synthetic peptide located within the following region: PQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGI |
Goat Anti-PXR / NR1I2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EQFAITLKSYIECNR, from the internal region of the protein sequence according to NP_003880.3; NP_071285.1; NP_148934.1. |
Rabbit Polyclonal Anti-NR1I2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NR1I2 antibody is: synthetic peptide directed towards the N-terminal region of Human NR1I2. Synthetic peptide located within the following region: AELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVG |
Rabbit Polyclonal Anti-NR1I2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the N terminal of human NR1I2. Synthetic peptide located within the following region: MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATG |
Rabbit Polyclonal Anti-NR1I2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the N terminal of human NR1I2. Synthetic peptide located within the following region: KKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDA |
Rabbit Polyclonal Anti-NR1I2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the N terminal of human NR1I2. Synthetic peptide located within the following region: EVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGY |