Germany
Japan
United Kingdom
China
MMP-28 Rabbit Polyclonal (aa298-312) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | MMP28 antibody was raised against synthetic peptide from human MMP28. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-MMP28 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP28 antibody is: synthetic peptide directed towards the N-terminal region of Human MMP28. Synthetic peptide located within the following region: LDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWV |
Rabbit anti MMP-28 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-MMP28 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human matrix metallopeptidase 28 |
MMP28 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- MMP28
Clonalities
- Polyclonal
Families
- Protease