TRIB2 goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Bat, Bovine, Canine, Equine, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus |
Immunogen | Synthetic peptide from human TRIB2 |
TRIB2 goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Bat, Bovine, Canine, Equine, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus |
Immunogen | Synthetic peptide from human TRIB2 |
Rabbit Polyclonal Anti-TRIB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TRIB2 Antibody: synthetic peptide directed towards the middle region of human TRIB2. Synthetic peptide located within the following region: YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE |
Rabbit Polyclonal Anti-TRIB2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |