Antibodies

View as table Download

Rabbit Polyclonal DNMT3B Antibody

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using 3 KLH-conjugated synthetic peptides containing sequences from different parts of the protein.

Rabbit Polyclonal DNMT3B Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using a KLH-conjugated synthetic peptide containing a sequence from the N-terminal part of the protein

Rabbit polyclonal anti-DNMT3B antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human DNMT3B.

Rabbit polyclonal GOT2 Antibody (N-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2.

DNMT3B (1-50) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from Human DNMT3B (aa 1-50)

DNMT3B Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human DNMT3B

Rabbit polyclonal Anti-DNMT3B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3B antibody: synthetic peptide directed towards the middle region of human DNMT3B. Synthetic peptide located within the following region: GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC

Goat Polyclonal Antibody against GOT2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SNLKKEGSTHNWQH, from the internal region of the protein sequence according to NP_002071.2.

Goat Polyclonal Antibody against GOT2 (Internal Region)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CKDADEAKRVES, from the internal region of the protein sequence according to NP_002071.2.

GOT2 Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region (QGYRYYDPKTCGFD)

Rabbit Polyclonal Anti-GOT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GOT2 Antibody: synthetic peptide directed towards the N terminal of human GOT2. Synthetic peptide located within the following region: VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEA

Rabbit Polyclonal Anti-GOT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GOT2 Antibody: synthetic peptide directed towards the N terminal of human GOT2. Synthetic peptide located within the following region: PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA

Rabbit Polyclonal Anti-GOT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GOT2

GOT2 Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GOT2

Rabbit Polyclonal anti-DNMT3B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DNMT3B

Rabbit Polyclonal anti-DNMT3B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DNMT3B