Germany
Japan
United Kingdom
China
Rabbit anti-DHFR Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DHFR |
Antibodies
View as table Download
Anti-DHFR Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit anti-ATIC Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATIC |
Rabbit polyclonal antibody to ATIC (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 310 and 580 of ATIC (Uniprot ID#P31939) |
Rabbit Polyclonal Anti-MTHFD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the N terminal of human MTHFD1. Synthetic peptide located within the following region: RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD |
Rabbit Polyclonal Anti-ATIC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATIC antibody: synthetic peptide directed towards the middle region of human ATIC. Synthetic peptide located within the following region: RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT |
Rabbit Polyclonal Anti-MTHFD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the middle region of human MTHFD1. Synthetic peptide located within the following region: CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPG |
Goat Anti-MTHFD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RGDLNDCFIPCTPK, from the internal region of the protein sequence according to NP_005947.2. |
Rabbit Polyclonal Anti-ATIC Antibody
| Applications | WB |
| Reactivities | Hamster, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATIC antibody: synthetic peptide directed towards the N terminal of human ATIC. Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG |
Rabbit Polyclonal Anti-ATIC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATIC |
Active filters
Clonalities
- Polyclonal
Families
- Stem cell - Pluripotency
Pathways
- One carbon pool by folate