Antibodies

View as table Download

Rabbit Polyclonal Anti-ANXA3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ANXA3

Annexin A3 (ANXA3) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse

Rabbit Polyclonal Anti-ANXA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the N terminal of human ANXA3. Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN

Rabbit Polyclonal Anti-ANXA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the C terminal of human ANXA3. Synthetic peptide located within the following region: RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD