Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CTCF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTCF antibody: synthetic peptide directed towards the N terminal of human CTCF. Synthetic peptide located within the following region: MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEV |
Rabbit Polyclonal Anti-CTCF Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTCF antibody: synthetic peptide directed towards the N terminal of human CTCF. Synthetic peptide located within the following region: GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEE |
Rabbit polyclonal anti-CTCF (Boris) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 14 of rat BORIS |
Rabbit polyclonal anti-CTCF antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CTCF affinity purified antibody was prepared by repeated immunizations with a synthetic peptide corresponding to a region near the C-terminus of CTCF protein. |
Active filters
Target Symbol
- CTCF
Clonalities
- Polyclonal
Families
- Transcription Factors