Antibodies

Jump to Filters
View as table Download
POU4F3 Rabbit Polyclonal Antibody
TA314363

USD 345.00

In Stock

Rabbit polyclonal anti-POU4F3 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human POU4F3.
POU4F3 Rabbit Polyclonal Antibody
TA332118

USD 310.00

5 Days

Rabbit Polyclonal Anti-POU4F3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-POU4F3 Antibody: synthetic peptide directed towards the middle region of human POU4F3. Synthetic peptide located within the following region: ALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYR
POU4F3 Goat Polyclonal Antibody
TA311245

USD 375.00

5 Days

Goat Anti-POU4F3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-EAAYREKNSKPE, from the internal region of the protein sequence according to NP_002691.1.