Rabbit polyclonal anti-POU4F3 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human POU4F3. |
Rabbit polyclonal anti-POU4F3 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human POU4F3. |
Rabbit Polyclonal Anti-POU4F3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-POU4F3 Antibody: synthetic peptide directed towards the middle region of human POU4F3. Synthetic peptide located within the following region: ALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYR |
Goat Anti-POU4F3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EAAYREKNSKPE, from the internal region of the protein sequence according to NP_002691.1. |