Antibodies

View as table Download

Rabbit Polyclonal SAP30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SAP30 antibody: human SAP30 (Sin3-associated polypeptide, 30kDa), using the full length His-tagged protein.

Rabbit Polyclonal SAP30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SAP30 antibody: human SAP30 (Sin3-associated polypeptide, 30kDa), using the full length His-tagged protein.

Rabbit Polyclonal Anti-SAP30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SAP30 antibody: synthetic peptide directed towards the N terminal of human SAP30. Synthetic peptide located within the following region: MNGFTPDEMSRGGDAAAAVAAVVAAAAAAASAGNGTGAGTGAEVPGAGAV

Rabbit Polyclonal Anti-SAP30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SAP30 antibody: synthetic peptide directed towards the middle region of human SAP30. Synthetic peptide located within the following region: YQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYF