Rabbit Polyclonal Anti-ZNF300 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF300 Antibody: synthetic peptide directed towards the N terminal of human ZNF300. Synthetic peptide located within the following region: FHHKILKGVTRDGSLCSILKVCQGDGQLQRFLENQDKLFRQVTFVNSKTV |
Rabbit Polyclonal Anti-ZNF300 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF300 antibody: synthetic peptide directed towards the N terminal of human ZNF300. Synthetic peptide located within the following region: DISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGSL |
Germany
Japan
United Kingdom
China