Antibodies

Jump to Filters
View as table Download
ABHD6 Rabbit Polyclonal Antibody
TA310087

USD 205.00

2 Weeks

Rabbit anti-ABHD6 polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ABHD6.
ABHD6 Rabbit Polyclonal Antibody
TA338020

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABHD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABHD6 antibody is: synthetic peptide directed towards the C-terminal region of Human ABHD6. Synthetic peptide located within the following region: MLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD