Angiopoietin like 7 (ANGPTL7) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 315-346 amino acids from the C-terminal region of human ANGPTL7 |
Angiopoietin like 7 (ANGPTL7) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 315-346 amino acids from the C-terminal region of human ANGPTL7 |
Angiopoietin like 7 (ANGPTL7) (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human ANGPTL7 |
Rabbit polyclonal anti-ANGPTL7 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ANGPTL7. |
Rabbit Polyclonal Anti-ANGPTL7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANGPTL7 antibody: synthetic peptide directed towards the middle region of human ANGPTL7. Synthetic peptide located within the following region: NQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSP |
Rabbit Polyclonal Anti-ANGPTL7 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ANGPTL7 |