Antibodies

Jump to Filters
View as table Download
CLCN3 Rabbit Polyclonal Antibody
TA590369

USD 409.00

In Stock

Rabbit Polyclonal CLCN3 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
CLCN3 Rabbit Polyclonal Antibody
TA338775

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLCN3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLCN3 antibody: synthetic peptide is 86% homologous to the C terminal of human CLCN3.. Synthetic peptide located within the following region: VGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVL