Antibodies

View as table Download

Goat Polyclonal Antibody against DPP10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DEGHNVSEKSKYHL, from the internal region of the protein sequence according to NP_065919.2; NP_001004360.1.

Rabbit Polyclonal DPP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to residues 521-539 of human DPP10.

Rabbit Polyclonal Anti-DPP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPP10 antibody: synthetic peptide directed towards the middle region of human DPP10. Synthetic peptide located within the following region: VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE

Rabbit Polyclonal Anti-DPP10 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Dipeptidylpeptidase 10 / DPP10 antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human DPP10. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Mouse, Rat, Hamster (93%); Opossum, Chicken (86%).

Rabbit Polyclonal Anti-DPP10 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Immunogen Dipeptidylpeptidase 10 / DPP10 antibody was raised against synthetic 15 amino acid peptide from extracellular domain of human DPP10. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Bovine, Panda, Horse, Rabbit, Pig (100%); Gibbon, Dog (93%); Bat, Elephant (87%).

Rabbit Polyclonal Anti-DPP10 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen Dipeptidylpeptidase 10 / DPP10 antibody was raised against synthetic 17 amino acid peptide from internal region of human DPP10. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Panda, Bovine, Dog, Horse, Guinea pig (100%); Galago, Bat, Rabbit, Pig (94%); Opossum, Turkey, Zebra finch, Chicken, Xenopus (88%); Mouse, Rat, Hamster, Elephant (82%).