Rabbit Polyclonal Anti-GPNMB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPNMB Antibody: synthetic peptide directed towards the N terminal of human GPNMB. Synthetic peptide located within the following region: DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN |
Rabbit Polyclonal Anti-GPNMB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPNMB Antibody: synthetic peptide directed towards the N terminal of human GPNMB. Synthetic peptide located within the following region: KGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNE |
Rabbit Polyclonal Anti-GPNMB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPNMB Antibody: synthetic peptide directed towards the N terminal of human GPNMB. Synthetic peptide located within the following region: DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSV |
Germany
Japan
United Kingdom
China
