Antibodies

Jump to Filters
View as table Download
OR4A16 Rabbit Polyclonal Antibody
TA315847

USD 345.00

In Stock

Rabbit polyclonal anti-OR4A16 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR4A16.
OR4A16 Rabbit Polyclonal Antibody
TA337500

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR4A16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR4A16 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4A16. Synthetic peptide located within the following region: FLLISCGVILNFLKTYSQEERHKALPTCISHIIVVALVFVPCIFMYVRPV