Rabbit Polyclonal Anti-SLC5A7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC5A7 Antibody: synthetic peptide directed towards the middle region of human SLC5A7. Synthetic peptide located within the following region: DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV |
Rabbit Polyclonal Anti-SLC5A7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC5A7 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC5A7. Synthetic peptide located within the following region: ILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNL |
Germany
Japan
United Kingdom
China