Antibodies

View as table Download

Rabbit polyclonal anti-ANGPTL7 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ANGPTL7.

Rabbit Polyclonal Anti-ANGPTL7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANGPTL7 antibody: synthetic peptide directed towards the middle region of human ANGPTL7. Synthetic peptide located within the following region: NQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSP

Rabbit Polyclonal Anti-ANGPTL7 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ANGPTL7

ANGPTL7 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ANGPTL7