Antibodies

View as table Download

Rabbit Polyclonal Anti-CD99L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD99L2 antibody: synthetic peptide directed towards the middle region of human CD99L2. Synthetic peptide located within the following region: RNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPG

CD99L2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-185 of human CD99L2 (NP_113650.2).
Modifications Unmodified