Antibodies

Jump to Filters
View as table Download
CLN6 Rabbit Polyclonal Antibody
TA315557

USD 345.00

In Stock

Rabbit polyclonal anti-CLN6 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CLN6.
CLN6 Rabbit Polyclonal Antibody
TA342045

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLN6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLN6 antibody: synthetic peptide directed towards the C terminal of human CLN6. Synthetic peptide located within the following region: RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA
CLN6 Rabbit Polyclonal Antibody
TA342044

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLN6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLN6 antibody: synthetic peptide directed towards the middle region of human CLN6. Synthetic peptide located within the following region: LPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNL
CLN6 Rabbit Polyclonal Antibody
TA374884

USD 220.00

3 Weeks

CLN6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CLN6.