Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-CYB5R3 / Dia 1 (mouse) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PNLERVGHPKERC, from the C-Terminus of the protein sequence according to NP_084063.1. |
Rabbit Polyclonal Anti-CYB5R3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYB5R3 antibody: synthetic peptide directed towards the C terminal of human CYB5R3. Synthetic peptide located within the following region: IRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLD |
CYB5R3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CYB5R3 |
CYB5R3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 125-334 of human CYB5R3 (NP_001165131.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CYB5R3
Isotypes
- IgG
Clonalities
- Polyclonal