Antibodies

Jump to Filters
View as table Download
Dcun1d2 Rabbit Polyclonal Antibody
TA332228

USD 375.00

5 Days

Rabbit Polyclonal Anti-Dcun1d2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Dcun1d2 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dcun1d2. Synthetic peptide located within the following region: MHKLKSAQKDKVRQFMACTQASERTAIYCLTQNEWKLDEATDSFFQNPEA