Antibodies

View as table Download

Rabbit polyclonal antibody to DNAI2 (dynein, axonemal, intermediate chain 2)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 382 and 605 of DNAI2 (Uniprot ID#Q9GZS0)

Rabbit polyclonal anti-DNAI2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human DNAI2.

Rabbit Polyclonal anti-DNAI2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNAI2 antibody: synthetic peptide directed towards the N terminal of human DNAI2. Synthetic peptide located within the following region: TRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHC

DNAI2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DNAI2

DNAI2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DNAI2