Antibodies

Jump to Filters
View as table Download
EDEM1 Rabbit Polyclonal Antibody
TA341949

USD 375.00

5 Days

Rabbit Polyclonal Anti-EDEM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDEM1 antibody: synthetic peptide directed towards the N terminal of human EDEM1. Synthetic peptide located within the following region: MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI
EDEM1 Rabbit Polyclonal Antibody
TA368215

USD 380.00

4 Weeks

EDEM1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EDEM1