Antibodies

Jump to Filters
View as table Download
ESD Rabbit Polyclonal Antibody
TA344262

USD 475.00

5 Days

Rabbit Polyclonal Anti-ESD Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ESD antibody: synthetic peptide directed towards the N terminal of human ESD. Synthetic peptide located within the following region: MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW
ESD Rabbit Polyclonal Antibody
TA375990

USD 220.00

3 Weeks

ESD Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-282 of human ESD (NP_001975.1).
Modifications Unmodified