Rabbit Polyclonal Anti-EXOSC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC2 antibody: synthetic peptide directed towards the N terminal of human EXOSC2. Synthetic peptide located within the following region: RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV |
Rabbit Polyclonal Anti-EXOSC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC2 antibody: synthetic peptide directed towards the middle region of human EXOSC2. Synthetic peptide located within the following region: AEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCG |
EXOSC2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-293 of human EXOSC2 (NP_055100.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
