Antibodies

View as table Download

Goat Polyclonal Antibody against FSTL1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TAEKTKRVSTKEI, from the C Terminus of the protein sequence according to NP_009016.1.

Rabbit Polyclonal FSTL1 Antibody

Applications ELISA, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal Anti-FSTL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FSTL1 antibody: synthetic peptide directed towards the C terminal of human FSTL1. Synthetic peptide located within the following region: LNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKN

Rabbit Polyclonal Anti-FSTL1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FSTL1

FSTL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FSTL1

FSTL1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-308 of human FSTL1 (NP_009016.1).
Modifications Unmodified